General Information

  • ID:  hor005235
  • Uniprot ID:  P56717
  • Protein name:  Orexin-A
  • Gene name:  HCRT
  • Organism:  Bos taurus (Bovine)
  • Family:  Orexin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005791 rough endoplasmic reticulum; GO:0031410 cytoplasmic vesicle; GO:0045202 synapse; GO:0048471 perinuclear region of cytoplasm

Sequence Information

  • Sequence:  QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTL
  • Length:  33(34-66)
  • Propeptide:  MNPSSTKVSWATVTLLLLLLLLPPALLSPGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRPGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPALRPCSGRRCPSEAASSVAPGGRSGV
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid;T33 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Play a significant role in the regulation of food intake and sleep-wakefulness. homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  HCRTR1, HCRTR2
  • Target Unid:  Q0GBZ5, F1MG23
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-12; 7-14
  • Structure ID:  AF-P56717-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005235_AF2.pdbhor005235_ESM.pdb

Physical Information

Mass: 415418 Formula: C152H249N47O45S4
Absent amino acids: FMVW Common amino acids: L
pI: 7.95 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 10
Hydrophobicity: -6.06 Boman Index: -3883
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 91.82
Instability Index: 2749.09 Extinction Coefficient cystines: 1740
Absorbance 280nm: 54.38

Literature

  • PubMed ID:  9491897
  • Title:  Orexins and orexin receptors: a family of hypothalamic neuropeptides and G protein-coupled receptors that regulate feeding behavior.